PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi05g02960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 1032aa    MW: 113841 Da    PI: 6.8875
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi05g02960.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.17.8e-41147224178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cqve+C+adls+ak+yhrrhkvC++hska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Vradi05g02960.1 147 VCQVEDCRADLSNAKDYHRRHKVCDMHSKASKALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTHP 224
                      6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-32144209IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.171145222IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.03E-38146226IPR004333Transcription factor, SBP-box
PfamPF031104.8E-29148221IPR004333Transcription factor, SBP-box
SuperFamilySSF484031.27E-6800914IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.205.7E-5802915IPR020683Ankyrin repeat-containing domain
CDDcd002041.77E-6803913No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1032 aa     Download sequence    Send to blast
MEAQLEGKNQ YLYGPVVPEM KSVGKRSLEW DLNDWKWDGD LFTATQLNSV PSDCTSRQLF  60
PADPEILAAG DASNSLSSSY DDVNLAEGRR ELEKRRRGVA DEGGVEMNDG AGSLNLNLGV  120
QVYPIIEGEE KSGKKTKITG STLNRAVCQV EDCRADLSNA KDYHRRHKVC DMHSKASKAL  180
VGNVMQRFCQ QCSRFHVLQE FDEGKRSCRR RLAGHNKRRR KTHPDASVVN DGSVNEEKGS  240
SYLLMSLLRI LSNMHSNGSD NMTSQDVLSH LLRNLASLAG TINGRNIVSL LEGSQDLVKA  300
GTSGTAPNVP NTNSNGPETS RPVDTSTKMD NGVISQDPPE SMVQCEMTPA NGMPKGFIAS  360
GSDGIGSSKS PSLPQLSNAL LSRDSLPPYS VSAETTVGRI GLSNIDLNSA YDDVQDYVEN  420
TRNSRPPLPS GNGSLDNPLW VQCDSLKSSP PQTSRNSDST STQSPSSSSG EAQSRTDRIV  480
FKLFGKAPND FPHTLRSQIL NWLSHSPTEI ESYIRPGCII LTVYLRLENS AWEELCHNLG  540
SSLRKLAVPN DSFWRSGWIY TRVQHSVAFL YNGQVVLDVP LRFKSPQNCQ IFCVKPLAVS  600
SSSCVRFIVK GFNLFLSNTR LLCALEGKYL VQDNCYDLVD ADASIEHNEL QHLSFSCSIP  660
NVTGRGFIEV EDNGLSSCSF PFIVAEQEIC SEICKLENVI EAAETADDIQ MRTKLMEEKT  720
QALYFVQEMG WLLHRNRAKV RLGPVAPLQD CFHFNRFMWL VGFSMDHDWC AVMKKLLNII  780
FEGTVDIGEH TSVELALLKM DLLHKAVKRN CRPMVELLLK FVPANASDGG DSKEKQVNKS  840
PNRFIFRPDS VGPAGLTPLH VAASIHGLDN VLDALTDDPG LVGIEAWKSA QDTTGLTPYD  900
HASLRGYYSY IQLVQRKISN TCKSEHVLNI PGTLVDSNIK QKQSDGHRSS KVSSLQTEKI  960
ETTAMVRHCG VCQHKLAYGG MRSALVYRPA MLSMVAIAAV CVCVALLFKS SPKVYYVFQP  1020
FSWESLEYGS M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-301472211084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1216222KRRRKTH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014501155.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X2
TrEMBLA0A0S3RH590.0A0A0S3RH59_PHAAN; Uncharacterized protein
STRINGGLYMA09G09790.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1